Pay in 4 interest-free payments of $6.28 Learn more
Ships within 48 hours · Estimated delivery Aug 6 - Aug 11
In stock $71.99 - $89.99 You save $79.99 - $99.99 You save $79.99 - $99.99 You save $23.99 - $29.99 You save $23.99 - $29.99 You save $31.99 - $39.99 You save $39.99 - $49.99 You save $39.99 - $49.99 You save Support when you need it
Cagrilintide 5mg Strength: 5 mg CAS: 1415456-99-3 Chemical Formula: CHNOS Molecular weight: 4409 g/mol Peptide Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP Synonyms: NN0174-0833, AM833, EX-A10092 Storage: Store 28 C (20 C long-term)
Standard practice for this class of research compound includes verifying identity and purity prior to release, and, where available, issuing batch-specific documentation such as a Certificate of Analysis (COA) so researchers can independently verify the material they receive
Fatigue can have many causes, including stress, poor sleep, hormone issues, nutritional deficiencies, or other medical concerns
Quick response and delivery
00188-7/asset/2c20a909-3c0e-4be2-9bc4-c699b73fc56e/main.assets/gr2_lrg.jpg)
